75 173 194 159 clsp qwest net  

p5b22c7da dip0 t ipconnect de6158
p5b15266a dip0 t ipconnect de8366
infofrankfurt de5240
dxneuro com2527
💜💕️👉 host86 170 106 229 range86 170 btcentralplus com3978
75 173 194 159 clsp qwest net 8834
n219077128105 netvigator com2251
coppercreekcandles com7420
ppp 70 248 114 249 dsl rcsntx swbell net3414
shopscrapmuch blogspot de7650
═ deltaenterprise net4652
reliantsolutionsaz com2613
dljt fd666hao27 com2240
pool 151 198 23 248 mad east verizon net4740
ool 457c9e07 dyn optonline net6714
aesthetic editor tumblr com2246
samstrausss tumblr com2086
75 173 194 159 clsp qwest net6555
nestproje com2800
💚💛💜 crimer com8469
shullfamily2010 blogspot com8404
50 243 7 170 static hfc comcastbusiness net4573
firmolin com6416
springlakes com5855
x4d044101 dyn telefonica de6588
mail gartenlandschaftsbau gera de3861
laz0mbie tumblr com4317
uk security yahoo com5681
acasadirenee blogspot com7933
shoresinternational com8674
p508132a4 dip0 t ipconnect de3826
💛 mx timeisnow shop cust b hostedemail com2300
i3ocsa fanhualiaoning com3814
hiramsmith tumblr com2742
kleines kurhaus de5882
muething mulcher de4355
lady love 143 tumblr com3741
💚 x2f3b5f9 dyn telefonica de4680
node 4u1 pool 118 173 dynamic totinternet net8518
africanadecontratas com5216
h69 129 15 196 btlral dsl dynamic tds net3083
forestbuilders com4396
portal solvay com cdnga net6288
❤️ precision2020 com7049
lebensart design de3682
rentalreviews com3142
vowkeeper tumblr com3914
h3 23 131 174 dynamic ip windstream net8136
484254 sanjianglive com8408
securityfcu com6428
end fangzizhuangxiu92 com4801
cxytz com7278
201 171 106 175 dsl dyn telnor net8520
207 224 125 92 clsp qwest net2705
🌸 defton com2310
174 red 88 14 226 dynamicip rima tde net7430
static 189 34 226 77 ipcom comunitel net5642
levelupmarketing ru mail protection outlook com6985
transitsoft de5377
hamptonsappraisal com8968
💜 skinnysweetxo tumblr com3013
a23 206 164 157 deploy static akamaitechnologies com5321
jessiefromtheblock wordpress com5109
hbgzd com4980
tohmann de2142
miklie com5186
💜❤️💜 1c 7nt com3677
healthconnectionnetwork com7467
154 red 83 41 186 dynamicip rima tde net7650
s33iva storage yandex net3305
hangzhouzaixian com4390
175 red 83 45 75 dynamicip rima tde net7152
💕 pool 213 162 142 109 dynamic wobline ip de6903
mis screwy2mars skyrock com3681
yxkidl6 akistv com5254
💜 211 208 22 109 rev sfr net6766
ethernet3 1 1 s25 d ashburn va ndcasbn comcast net6579
mail sabae panda com2934
jomrich de5229
gophergrass com8810
p54bcda31 dip0 t ipconnect de7822
nhculture net7158
laramieloans com2562
cygb1312 tumblr com5358
═❤️❤️❤️❤️══ templetes com6867
santa isabella de2071
whiteboardps com3969
dutysciences com2569
cpc1 mort8 2 0 cust295 19 2 cable virginm net1944
tmber net6632
🍎 gp reports viewer for great plains software informer com8540
c 67 172 65 141 hsd1 fl comcast net3755
rumah uangmuka murahsubsidi bekasi blogspot com8137
adsl 76 227 139 221 dsl skt2ca sbcglobal net4397
briberrybaby blog tumblr com7007
birgit wallisch de4486
💗 node 2569 tor pppoe execulink com8000
jtm671 skyrock com7177
softbank060112077205 bbtec net4784
azako de8931
75 161 46 16 albq qwest net6493
functionalsinner blogspot com2857
❤️🔥🤤 bhir7 weifarm com3345
neispreis de8857
taocichahuapin vvvqqq com4133
blackrozez tumblr com6122
hssdz giaitri4u com4702
c 73 169 240 31 hsd1 wa comcast net8806
🍎 robandtiz net2224
poemebyemi skyrock com3731
drterlep com8835
house beautiful magazine pissedconsumer com4547
static 71 246 25 213 phlapa ftas verizon net8143
nsepl com2674
🔴 🔴 🔴 pool 96 224 231 167 nwrknj fios verizon net2051
adsl 71 145 162 80 dsl austtx sbcglobal net7399
81 89 108 102 blue kundencontroller de8279
a88 221 182 62 deploy static akamaitechnologies com3088
0jc0zom gzcarefree28 com3088
beatsensation de8661
👉 a104 71 87 52 deploy static akamaitechnologies com3188
114 40 73 232 dynamic hinet net5746
cxsweden com5112
❤️ 23 24 15 209 static hfc comcastbusiness net6025
costinaniko blog tumblr com7126
zfcb ye26qq2 com8973
71 32 152 7 chyn qwest net2333
xtremebooty com6409
ebony ass fucking x take com6382
🌸 153 red 83 60 61 dynamicip rima tde net5150
125 red 83 40 108 dynamicip rima tde net5324
adsl 76 254 3 29 dsl pltn13 sbcglobal net4024
⫷▓🍏▓⫸ floremorton com6246
a23 76 234 116 deploy static akamaitechnologies com 37336174 qeB 072 178 212 240 res spectrum com 12888158 7aR
206 red 88 16 90 dynamicip rima tde net 84372485 Flk
va 67 233 90 17 dhcp embarqhsd net 28763080 uNY xsyin com 41154304 e2S
hoteleriaargentina com 23702781 OS7
timespoints com 80542348 JJp h254 159 132 40 static ip windstream net 67706269 roq pinterest
pool 72 70 155 194 hrbgpa east verizon net 20784456 dJV
adsl 71 133 132 46 dsl pltn13 pacbell net 55847686 Op7 the song in my heartt blogspot com 99755576 9M1
cpe 98 14 51 32 nyc res rr com 40483583 BCJ
hroub com 32795368 b1p maifest riedhausen de 48964947 VTq
alexgruenberg de 82008620 HCA
mail palmenanzucht de 92471736 zrx pool 71 181 149 233 sctnpa east verizon net 84646611 bBT
ns2 c35983 sgvps net 20667652 w4s
glencovelawyer net 53582150 pox halo115 tumblr com 37832270 vVo
pool 100 7 57 10 rcmdva fios verizon net 92276845 dl4
michaelpiercephotography com 47608240 Q2t 140 red 88 12 94 dynamicip rima tde net 11533168 OQq
synkronizer de 48676976 W79
cpe 66 8 142 142 hawaii res rr com 60850228 Evd host 091 097 099 113 ewe ip backbone de 31835501 rwr
pd958ed93 dip0 t ipconnect de 98927726 iHw
c 73 79 123 34 hsd1 md comcast net 048739182 wvv jeannebaileyassociates com 079981319 3mI
veroniquebonnecaze com 06607994 5Ns
smtp1 thunderluckpromos net 092945167 LUA thefancy media ec6 thefancy com 057551111 1aM
ecuz net 099568404 sw9
adsl 75 24 203 214 dsl scrm01 sbcglobal net 064064397 5Hz collarbonecowgirl tumblr com 028668008 LHr
p5481a97a dip0 t ipconnect de 093690191 71N
uucspokane com 15856841 uxJ romantikhotel dorotheenhof de 63141101 kla
184146 asm62 com 20388335 3xU
kaos im web de 85090744 BnJ our fantasylife69 stuff tumblr com 13281835 YiP
studienteilnehmergesucht de 79049583 nCq
c 67 182 234 102 hsd1 ut comcast net 44958989 mVu sancaktepehavalandirmafirmalari wordpress com 66879680 56D
p57b1f9b3 dip0 t ipconnect de 26415394 HCy
lns bzn 46 82 253 213 195 adsl proxad net 86679852 iZv c 76 105 89 185 hsd1 ga comcast net 82015127 XSA
haldenwofford com 86580567 JKO
dslb 146 060 098 133 146 060 pools vodafone ip de 37700594 Lm3 ramaze de 19610006 oBT
jingdianpensufenmo sssrrr com 97230066 w0a
iloveonedirectionsobad tumblr com 25436082 WhE letyourbodyshine com 97336543 KbU
adsl 75 46 39 27 dsl sfldmi sbcglobal net 3561960 IlH
pc 187 249 120 200 cm vtr net 70469605 tuH c 69 243 85 128 hsd1 md comcast net 8872735 qFF
schleppmesser de 77068938 Vqh
h120 110 31 71 dynamic ip windstream net 39260963 jUz princessmunkie tumblr com 42868325 H9h
telemediastore de 90100474 dFJ
azu mi com 93154626 ZyQ a23 44 44 44 deploy static akamaitechnologies com 56452409 3wf
myquestlink com 6865457 HqL
cpe 70 95 215 139 san res rr com 014869585 J7u adsl 76 208 81 55 dsl ksc2mo sbcglobal net 052192970 Ehb
emisop kimwigginsart com 071878861 Rwb
schubert oldenburg de 096070754 vF1 ip5b41981a dynamic kabel deutschland de 06820408 q6N
trade club de 014412963 eJo
p5dd45c53 dip0 t ipconnect de 030078104 986 shinybrian blogspot com 068086736 cIo
livinglifeasmeforyou piczo com 095728999 Hbw
hotel kaiserquelle com 13537603 6GD automatedadvisorpostards com 14894904 jPs
jaimelesfilles canalblog com 2248529 l2t
171 red 79 144 70 dynamicip rima tde net 74374305 2RP sulserio tumblr com 95751517 qL3
mail al aneqa com 42125045 VlN
vestrahost com 57751523 M5W ns verecom com 39596717 7tv
adsl 76 233 104 228 dsl rcsntx sbcglobal net 67014007 Avq
amicsdelball com 95955722 DYE 154 0 29 109 rev sfr net 47690724 Jph
96 8 186 184 block0 gvtc com 24431948 qFb
auntshirleysspices com 69260084 lKy datacombilisim net 35975860 l3f
c 76 119 241 91 hsd1 ma comcast net 58924357 tPk
heike penningbernd de 1099826 j1Q pool 71 169 47 114 pghkny east verizon net 52384554 lWn
torqueoftown blogspot com 79898154 heb
c 67 164 170 20 hsd1 co comcast net 24074294 Uvu 97 118 12 65 hlrn qwest net 39958944 pbe
wallstreetannals com 88131268 fj9
pineridgeltd com relay1a spamh com 43262594 jI4 static 88 198 138 201 clients your server de 38526352 uQg
rockamturm de 41686286 Je3
adsl 76 201 177 228 dsl rcsntx sbcglobal net 53194073 pnR mail werk chor rasselstein de 65313525 7Fd
opelmitarbeiterfahrzeuge de 43871365 7Hv
mail arnold tec com 080467952 hzY cpc116330 smal16 2 0 cust558 19 1 cable virginm net 021327049 ciw
opel epple rutesheim de 087357280 0mC
c 73 186 33 242 hsd1 ma comcast net 078014798 cjN nous6767 skyblog com 066739866 fhA
doubley com 019060026 TUV
be smile happy tumblr com 039937089 8SE adsl 76 223 254 125 dsl emhril sbcglobal net 036718946 n1Q
muffinn1234 tumblr com 06704629 fKu
longin finanzberatung com 16068769 wzx 96 127 196 68 qc cable ebox net 2998259 dtQ
mamidakishotels com 93585100 2Cv
audrey ng90 blogspot com 43738565 kyM dslb 002 205 000 139 002 205 pools vodafone ip de 91245085 RjS
kelsohensley tumblr com 43652964 5qf
70 58 242 73 phnx qwest net 16698463 dHM 202 147 224 89 dsl completel net 96556409 sSG
jiankuaizuowen com 33211152 6lY
mx jeach com 52789993 KVJ irondeanloverhuman tumblr com 1937895 93m
server apexcreate com 93541980 g5H
5ec15c96 skybroadband com 81385422 HP6 antikrisenbuch de 33462785 uwW
x soutener tous paraze x skyrock com 39062569 miR
atmoskoop com 59334969 TSH bohm computer de 6115162 kfb
woohyukjang com 87156484 Hr7
petrainbowmemorial net 71862383 Ydt 107 red 80 39 235 dynamicip rima tde net 18338915 O3l
p4fe8beb9 dip0 t ipconnect de 55523554 2M9
74 47 147 249 dsl1 fairport roch ny frontiernet net 92018304 UNR habandm com 7519132 6yv
x5d874149 dyn telefonica de 38779153 fsU
laozj com 40498939 NLi o2kids de 94224776 0GQ
mail sterlingfox net 90764451 Bau
static 52 170 145 212 ipcom comunitel net 093471519 7F6 antigray net 087897651 M7p
perksofmybooks tumblr com 088348012 mOV
shoppingyard com 054979882 plO darkelfdice com 097816474 Md0
hoff24 de 030702830 uTT
125 229 194 235 dynamic hinet net 027262782 YBK host31 48 144 56 range31 48 btcentralplus com 039091614 37M
tearsforskinny tumblr com 094208174 VEk
discountaircompressors com 89690503 JYD 45zeroprod skyrock com 21712608 MgJ
23 120 235 97 lightspeed irvnca sbcglobal net 71322677 DTQ
objekt m de 33899810 nWW turki34 tumblr com 81107276 U9u
adsl 70 229 86 193 dsl chcgil ameritech net 77700981 q7N
festivalmoussainvite sitew com 86115154 kGU pool 71 185 146 190 phlapa east verizon net 80244739 few
arcognizance com 91723283 FWR
cy1myby pxmining com 53849556 42u static 188 234 76 144 clients your server de 17873378 IDW
watsonexcavating com 29237307 XIh
gl01 005 gl01 cilas net 54159439 odP siostryfigofago blogspot com 67307982 prt
p57a7af0b dip0 t ipconnect de 3021294 63F
pool 71 166 5 76 bltmmd east verizon net 93048626 6V4 a104 107 81 73 deploy static akamaitechnologies com 37830297 St4
anticute marshmallowmars tumblr com 94622922 aYQ
ppp 70 242 9 126 dsl hstntx swbell net 53665878 Pg8 chattermaxim kulando de 56506206 ydc
252 199 98 84 rev sfr net 20320662 2dS
108 sub 75 218 156 myvzw com 95204351 Byi zooe0 taccurrency com 35747443 ckn
c 68 39 157 104 hsd1 pa comcast net 27982630 4JE
midwestindependent com 95499085 p3r waitforitillwritemywayout tumblr com 35138539 Mnz
paigeonemarketing com 72444261 S6r
p57ac32c9 dip0 t ipconnect de 015352099 Zyt mail abara info de 089505919 K2o
fallen angel azel tumblr com 068730548 9R2
192 sub 75 196 159 myvzw com 066483117 30m the limitdoesnot exist tumblr com 052078591 Rgw
static 71 252 124 21 washdc east verizon net 010770685 CYy
ocnywest com mail protection outlook com 032465334 3vq boneterkini1 blogspot com 070188434 jNY
easyvans com 063419243 hX9
p508a7f36 dip0 t ipconnect de 67321688 mRm eelsocks tumblr com 28241444 G2m
h93 131 17 98 static ip windstream net 20917713 zDQ
machaikfordjackson com 34026703 h2H inbound 191broadway com netsolmail net 73709540 hCO
officeflavors com 67092514 ev7
68 121 157 129 ded pacbell net 77728833 H3e p549ab4e5 dip0 t ipconnect de 25798722 MNm
mail net4office de 27228881 XFd
g6renard wordpress com 71396493 6WS legaldrive de 42453491 seH
5starmailings com 25878357 xtW
elizaproszczuk com 46044525 DyT siloahpatenschaft files wordpress com 76423456 S4F
acvftfe net 27744194 NQO
ipservice 092 213 251 145 092 213 pools vodafone ip de 64126304 q5a p5b06fbb7 dip0 t ipconnect de 75403341 gcd
zsamc com 72385729 1AB
steinburg net 95999709 pEi c 98 231 133 248 hsd1 md comcast net 83034685 BzW
68 red 79 147 35 dynamicip rima tde net 21665200 O0E
h47 151 16 98 static ip windstream net 85924421 Js4 dsctest com bak mx smtproutes com 46903429 iKa
young lionxss tumblr com 1237335 1Jn
shopsueyluxe com 7498669 kwm c 71 237 254 203 hsd1 or comcast net 42161183 i3D
ufnbmn fanhualiaoning com 61685767 dw0
pool 96 252 36 82 bstnma fios verizon net 03927664 Zbi vs245190 vserver de 088120033 DDv
lettherebefood files wordpress com 023786102 7t3
lottoleaks com 080233738 MP0 1ship8 com 06333487 EJS
114 44 97 235 dynamic hinet net 019397037 sXW
fashionlovesyou com 053588231 ZjB lawandordervocabu tripod com 072654513 h2C
dansmnptitmonde skyrock com 034833927 aCi
jenniferrandall net 84855188 xtn pilz treff de 83569321 kMi
bzq 84 108 9 164 cablep bezeqint net 77061839 Vvw
p5b3df3ac dip0 t ipconnect de 3239532 Tw0 houndfilms com au mail protection outlook com 22633896 tiC
global dragonest com 31879060 gFS
furryhusky 546 tumblr com 3397039 Vpf 108 80 247 42 lightspeed frsnca sbcglobal net 67601644 i7z
cluxe com 42826360 5El
us mx3 na mailanyone net 93038951 MSk npcrossing com 64195100 4e5
qsqauk wcwsz com 11393511 MnS
ghostisland com 16029869 Cfh kilmallockgaa com 13436727 kqX
wanderingakuta web fc2 com 2914487 OF4
99 35 16 166 lightspeed sntcca sbcglobal net 61727961 M02 25ahowtobuildupyourcreditscore blogspot com 33915099 okz
bodyshape editor it softonic com 47156478 nuc
c 73 118 244 51 hsd1 wa comcast net 2632964 J3j ns1 e systemsonline com 6324303 2dv
mail feuersteingmbh de 19793847 JW8
7obk3wj jinlechengcaifu com 22362047 Kw2 lapetitemissdu8516 skyrock com 1943089 Jx2
75 171 197 183 hlrn qwest net 28568394 wqy
hsi kbw 082 212 018 137 hsi kabelbw de 52657237 0OU pool 71 174 141 10 bstnma east verizon net 47443937 xiH
airconditioningschools com 23331052 6xi
rtmusiq bandcamp com 07857766 71n angelkeeper com 024918884 BaW
demositetitan sites cchifirm com 042975193 Ofc
dyndsl 085 016 150 131 ewe ip backbone de 094107779 DEU c 73 84 120 228 hsd1 fl comcast net 053942816 iQi
hygradetech com 072649416 5Aw
ipservice 092 212 026 083 092 212 pools vodafone ip de 089590503 G2X 104 sub 70 194 179 myvzw com 074098406 NZd
pd954af22 dip0 t ipconnect de 092473472 SbE
sanemeylul blog tumblr com 68493166 5pR pool 71 126 78 24 phlapa east verizon net 52395403 IO5
yourcrossvillerealtor net 2662755 vvP
h252 246 31 71 dynamic ip windstream net 99516092 I1B h133 198 23 98 ip windstream net 30845114 DDq
inukag 4ever tumblr com 82965357 PN9
mw esr1 72 49 220 85 fuse net 1550317 p8z softbank219063154181 bbtec net 99798227 AxH
marvelfanficswriter tumblr com 77805902 f5I
66 148 196 69 nw nuvox net 37193695 cCr dcmauto com 29119922 SHL
p4ff342c5 dip0 t ipconnect de 7633717 33v
locuscommunityimpact net 69949482 TqJ mail jurconsultant de 20819433 NIh
baumgartn3r de 19162449 fCZ
koellebaggert de 23042255 cTY ool 18bf3f6f dyn optonline net 30270579 Vkr
rent a watch de 98995408 om4
marcosjumper1 tumblr com 15525278 URA miiss laetitia skyrock com 70500784 jLj
alexandra k de 34588824 K96
nuevojorgechavez com 14977579 8yf lastminutezentrale de 36201748 aAK
1953018 free press release com 68313607 iRb
jaqhgrd pxmining com 82592017 yrJ griptapekings blog tumblr com 49289614 R9i
touchofclasslimousineservice com 19081926 rPm
typesetter tumblr com 048761584 5VR organismechoc com 079068904 5bW
soon2beskinny tumblr com 087259750 AZO
bried de 029118127 qTN adsl 71 146 78 112 dsl pltn13 sbcglobal net 080975909 IjS
blue monster tumblr com 084109107 lJe
129 red 83 39 11 dynamicip rima tde net 029945133 GcA sites br inter net 042012117 5n1
mail jomammele de 014839322 ZaU



c 75 69 159 180 hsd1 nh comcast net 5024558 crr dslb 188 104 121 091 188 104 pools vodafone ip de 15928562 ITU
pool 96 253 111 38 rcmdva fios verizon net 53830942 iTo
mew420 tumblr com 80156943 qiB bronst de 77126315 Y8I
jteezy6789 tumblr com 64918750 UT3
jq616 com 72877196 7fj vindieu com 94997941 BiY
66 227 172 6 dhcp aldl mi charter com 1695666 jIo



p5b2143c1 dip0 t ipconnect de 92419508 3xQ portsidebluebq eventbrite com 35768605 P0S
paradox design weebly com 71187090 k5e
c 73 82 110 152 hsd1 ga comcast net 14381808 X0r coolingwizard com 44008307 er4
x nabho x skyrock com 78817828 Q0o
ppp 69 151 178 211 dsl bumttx swbell net 50508611 2X1 mean petsherald com 17484635 5iv
inbetweenthelines com 63383647 hV7



tapsnaples com 53698210 u9m algreenday skyrock com 47413230 0H5
welcometotijuanakill blogspot com 5205928 X2n
athulrajmedia wordpress com 23221312 ylx farakav com 46387206 FT9
4908356 asphaltrats net 59777892 Vdx
x5f743929 dyn telefonica de 11835343 nJZ adsl 072 149 036 006 sip bct bellsouth net 51228168 EdJ
adsl 99 153 8 56 dsl applwi sbcglobal net 50342974 6Bn

hd21hdwvyi pixnet net 96734147 snq hdcintranet net 78464907 9cq
matmoti de 79406884 KLK

613 net 35320214 l9u herren sportschuhe de 56522795 bud
kratzer net 31338082 ba7


cnc saitenseiten de 38863795 cU7 casolutionsglobal com 87598395 4zw
druckerbernath stw uni kl de 93862090 yP4
hunterhrichards com 35409309 5w7 groovemusicapp com 97241257 3U3
br vivaldi net 40374173 e63
user 69 1 8 171 knology net 92485443 ftk ppp 70 243 40 248 dsl hstntx swbell net 57446992 DkD
allglobalnames com 17936408 KOq
rk finanz dienstleistung de 51360080 een bergmann dienstleistungen de 34535544 j0n
server dluxnyc com 36931275 pji
tiresupplynow com 71838233 AMc mail munguyenthuy com 97292658 HYs
friendsofchallenge de 29155589 cBF
gisl de 77716188 huz inbound viewscapeslighting com netsolmail net 35811434 Cqp
ebfr net 41772865 eCu
chantalism wordpress com 94732554 0z8 adsl 75 25 14 46 dsl irvnca sbcglobal net 8434793 jpE
5th avenue hoteles playadelcarmen com 16003398 tLz
p548aa25e dip0 t ipconnect de 29297042 zbG 97 41 113 92 pool ukrtel net 73391374 5dS
cdkunming com 27782979 9QC
cpe 76 94 167 145 socal res rr com 33738470 1dg spass online de 52782925 gFk
c 69 180 192 174 hsd1 tn comcast net 52161468 pPh
myibh de 045724262 MzJ marcadoreselke blogspot com 064679765 zKB
79 red 79 154 236 dynamicip rima tde net 089560678 9eL
cle bb 1 10 dsl airstreamcomm net 04348247 vMo rbc uwc de 085779581 x7m
frima neustadt de 08876668 xhe
63 157 167 66 dia static qwest net 09599176 jNJ iran juventus persiangig com 083750319 7fk
e2 hq gallicom net 07643215 UeT
darmstaedter tagblatt de 33275215 xnh adsl 69 107 139 112 dsl pltn13 pacbell net 39558651 Ejo
marine industries net 69891415 dvg
papsi net 57495302 M3A never kingdombks com 69417563 0Gg
rksi de 23209572 ngL
mail alexanderwild de 70500263 HTt 0178200 1 1 gw dd de net dtag de 94590414 gMX
posturecraft net 21400081 Hu9
dormlife net 35147640 e4y mickaelleevaristo blog tumblr com 66327819 d9b
dslb 088 070 182 048 088 070 pools vodafone ip de 71789360 kpL
rezzn net 82375944 CYZ theisaacmiranda blogspot com 51057251 SDM
schwanekamp holztechnik de 63871111 4oF
jackanoop 3dm3 com 1351957 1lR c 71 57 6 129 hsd1 in comcast net 84534129 GWZ
dpcatau livejournal com 77049535 26p
tik smadakediri blogspot com 94151456 9mW esteticauniversal tumblr com 3648846 iq0
c 73 35 137 227 hsd1 wa comcast net 36114964 C86
tradgety enthusist tumblr com 99228481 Npq tonje 50webs com 73008234 E7k
cubanculture net 85020748 Ekc
162 194 67 89 lightspeed snantx sbcglobal net 69118396 rNU yifawang com 68150705 As8
252 red 88 4 66 dynamicip rima tde net 59193174 rGi
chaoyangdistrict com 067904846 Ge0 p54b0ba93 dip0 t ipconnect de 035803957 117
adsl 71 159 142 179 dsl rcsntx sbcglobal net 032523517 OoT
i box de 03729211 RoV simplythread skincaretherapy net 076556736 dti
138 84 48 114 nextgentel com 026910743 46S
mail kiwiwebhost com 031242243 V9Q barnizadosmauri com 073190982 sT7
pool 72 68 39 39 nwrknj east verizon net 022885969 htO
brezenoff com 90906347 jIM p54849ccd dip0 t ipconnect de 22041219 KFH
fuck youpinkisthenewblack blog tumblr com 32225346 LM7
anfh de 15532573 fYg 11163249 141597 domain domaingateway com 65313284 8oZ
anadoluelektrik com 34587341 0ce
x4dbf403f dyn telefonica de 35669416 yHf 220 129 43 11 dynamic ip hinet net 32391519 B8l
63 230 203 2 phnx qwest net 42541451 YzC
vom haus schoetag de 4746961 ewH worldwidelogisticssolutions com 21038352 OH4
adsl 068 213 068 037 sip jax bellsouth net 18968793 WVo
omegageneration com 90443873 mZL neydharting de 17806885 vf5
evrendebiyerde tumblr com 80402627 B3s
selfpublishingcourse com 14172728 zcp mx allofuspropertymanagement com 28429252 Wze
ec2 108 128 131 178 eu west 1 compute amazonaws com 95165247 4Cx
demostreamingmb blogspot com 43717037 cfe pd950524b dip0 t ipconnect de 60352798 f4k
baker sssrrr com 2232455 oe8
137 red 83 57 25 dynamicip rima tde net 98745298 WdI brfeiras com 62812654 lvR
dioptric catoptric deactivated2 tumblr com 59926556 nDw
p4fc7aa91 dip0 t ipconnect de 51065868 TVz mail manellopez com 878269 4qs
glossopaccounts com 87439782 SdO
jeonlustial tumblr com 044475248 Ran hamlaw com 040576892 Xl5
89 1 149 209 dynamic barak online net 097371537 Lbt
clipsrules sourceforge net 035093758 Qdp aokchenggongsuzhixunlian vvvqqq com 09515083 beq
w01877ec kasserver com 081672866 wfE
totaladultcenter com 041770942 hwG rightproduct com 014373326 n28
blpprofessional com 023387517 ZIf
killerpraline de 48800860 H8y theinfamous374 tumblr com 9667304 GTe
c 71 62 239 124 hsd1 va comcast net 21331854 FVF
pool 108 41 108 73 nycmny fios verizon net 47559225 ScG legalservicesdirectory com 85524917 QXc
jenniferpooley com 57346895 LWD
checkpoint erotic de 98566370 ibn blackqueensonstage com 2457601 hE5
citimop com 25118164 Mj4
todoencloud com 27254809 V4C tn 67 232 95 149 dhcp embarqhsd net 64702529 3ss
x4db7fa77 dyn telefonica de 397631 mMX
patchworkandquilting com 65115564 6zt yoshouten com 72147616 D6F
itunesuncovered net 33842695 2Wa
c 67 188 146 60 hsd1 ca comcast net 9234940 S5L populationus tumblr com 55470674 ndQ
mx0 survivaltips de 12888012 gx4
vwg chengguoshangcheng com 39392949 Ftu ksrav com 47141362 VLr
h74 52 131 40 static ip windstream net 71904307 bRF
128 182 serialint fratm cc sccoast net 15698448 M7W cpc142154 sket4 2 0 cust861 7 3 cable virginm net 24139158 bBs
vfct8011 avnam net 18004431 I1l
forschner online de 8382634 uiS brittosidhan com 44647006 n5p
c 67 185 72 251 hsd1 wa comcast net 42557839 Fba
op fachpersonal de 099752735 zyU humanityonly com 079909827 MSq
70 43 9 70 nw nuvox net 090221746 yoa
cloud2 influxdata com 050099940 kyw cht e7play com 041192117 FUZ
softbank218125153097 bbtec net 033772855 IC8
p5b3aaf98 dip0 t ipconnect de 045629596 go5 pulpgenesis com 067278803 mBO
97 120 27 73 ptld qwest net 091514491 D7M
104 11 50 214 lightspeed brhmal sbcglobal net 85141804 wkR node gar pool 118 172 dynamic totinternet net 9182510 ipG
imfluss die lippe de 18031967 Ipm
50 41 121 161 athn oh frontiernet net 26503287 GL5 clintcoulsonficfinders tumblr com 7836783 igd
pool 100 0 13 229 bstnma fios verizon net 70632135 xT3
gojacky com 57870435 yRw sudd en ly tumblr com 321268 Ss0
pc 49 253 73 200 cm vtr net 27407147 p6Z
c 66 41 199 105 hsd1 mn comcast net 77491964 RBk h105 89 135 98 ip windstream net 52652930 45q
adsl 69 154 182 233 dsl hstntx swbell net 2328680 91m
webmaster utub com 86328056 yOu boyerrealty com 23646625 iYD
kindergeburtstag sh de 8074589 gnm
valedemi tumblr com 57193682 Pfp moviemanual com 68354999 xOf
antideutsche de 66736348 KDm
herma suggestsoft com 27195426 pGL hfdean com 72667846 YIm
reyhaningunlugu blogspot com 91923621 q8N
k4rim zik skyrock com 76339148 KDK booksrlove blogspot com 94526894 Dwf
71 80 136 232 static hspr ca charter com 82878438 Ahs
32 red 83 58 130 dynamicip rima tde net 18846251 OT8 shiyakusama69 photo 163 com 80787840 oFx
61 229 135 106 hinet ip hinet net 71001806 Q7Z
stonerkittty tumblr com 032813465 7tM iicon de 012483436 Rkz
twoperfection com 04243402 8ya
59 2b 32a9 ip4 static sl reverse com 067082359 ev4 rkandk com 086416068 owt
fresnopsychologists com 027240290 lP4
expertimmobilien duesseldorf de 058896460 rdi x4d0dbc41 dyn telefonica de 032472093 AzW
llidshop de 078123359 X5q
univ lyon1 jobteaser com 67445216 IBN hunde4rum de 73647318 Zzs
h217 215 129 40 static ip windstream net 74363806 BZh
c 24 20 190 110 hsd1 or comcast net 96520159 3om moosburger isar akademie de 12854945 ev5
playphrase com 22243251 ivO
drunkwby tumblr com 66478430 kjp rastalmacit dictionarweb com 36044838 pbV
768kk com 33769514 KSq
cpe 75 179 33 32 neo res rr com 83404278 o9a 495gs welosed com 2640577 3Ig
marple de 62267193 sDk
reading comprehension booster softsia com 35686243 1OE build9 com 46258886 I5d
sederlaw com 55102386 Yrp
toutpourlabiere com 43422001 Fvu 0gjuk1 fanhualiaoning com 24602674 L7v
franchise credit com 67023924 flp
bhjyhb com 73425155 rCc pool 96 240 12 58 nwrknj fios verizon net 96156839 bQp
mail bironhomes com 56051121 2Aj
photography by linek com 85153871 PqO carp for you de 73077748 e33
donnafeldman net 61647535 gvp
59 113 137 67 dynamic hinet net 7981864 FIV mail berlin turismo com 17894445 F72
heatrod com 89734341 Haq
dsl 208 64 73 127 mville mtcbroadband net 043275981 RUR 61 230 197 15 dynamic hinet net 078432195 gxy
klassy net 078278484 FB5
maroc moto 2007 blogspot com 049485498 cIb horizonfeedback wordpress com 059116522 BW3
serenehanzo blogspot com 074232596 NGR
schmitt nilson de 059975789 D6o cityleaders net 092643462 HFb
fockner immobilien de 083836538 yG4
jamiekristinephotography blogspot com 48401749 W9g nc 65 41 191 104 dyn embarqhsd net 70833224 Jck
53 red 79 151 157 dynamicip rima tde net 45482038 4yT
mail hauptstadt hauswartung de 5701050 4IW ge 7 1 9 100 taanqe10 dk ip tdc net 40908307 uoT
yur d tumblr com 8265944 kav
repanelled wordover com 1516839 cys 63 228 41 209 mpls qwest net 9661932 1No
goldhammershop de 10442304 gv0
pool 98 109 187 207 nwrknj fios verizon net 35668175 Is6 starnascience net 20579167 sfM
oh 76 6 163 158 dhcp embarqhsd net 7460010 fHU
mail koi led com 81436321 GWh ezhz de 93559035 Ulj
c 98 215 18 32 hsd1 il comcast net 2877632 4g5
va 67 233 73 33 dhcp embarqhsd net 33724582 WyS nokshifiles googlepages com 14240654 rIf
245 sub 75 250 220 myvzw com 36030308 K7p
ambulances cortenaises com 4343745 Tat atlantacomics com 48635100 h28
static 66 13 180 114 bdsl verizon net 68053302 o8r
edesignsuite com 18131405 EDt ogrencikredikarti com 39074488 NBk
digiscrapcafe tumblr com 47768788 MjH
forgingshops blogspot com 61404338 TLE corporativo de 67842922 m5a
kentucky baxter heartdetectives com 11341197 DLM
vehiclesepoca blogspot com 05425394 QW9 dynamichomeinspectionsllc com 056305194 Fvy
basketbretagne com 066796490 qtT
pool 70 22 42 226 balt east verizon net 063853110 IKP soundcard de 063181054 jiQ
pool 71 181 232 80 sctnpa east verizon net 026419064 Hrl
evabox de 038528502 CeJ 114 27 192 165 dynamic ip hinet net 050536282 lyY
ae0 300g ar5 mia1 gblx net 095999174 OAU
sumaryono com 90179214 Q6h vhsmemory wordpress com 71378724 gx8
tatt de 34060550 RPl
smsopwaarderen com 48602086 Iyv 3w363 martolea com 75995939 DXK
root perspektivenwechsel de 44575242 e4Y
fernseh hartwig de 32722512 Ivs 12 red 83 47 108 dynamicip rima tde net 56756113 FOW
radrokmma com 72185082 vYR
adsl 70 131 46 150 dsl emhril sbcglobal net 12857884 DaM joachimquantz de 4406975 r4C
xjeux ketchup skyrock com 15994932 d8E
bringoutthebestinyourself com 61682044 PJ3 influencemoney com 62948972 s4T
p548cb3e0 dip0 t ipconnect de 89735459 nDn
sh0pping freak blogspot com 60774907 jzR patientone net 75575033 pvQ
71 208 87 195 hlrn qwest net 44562990 8dO
alkhalayani wordpress com 72198649 2tx under muzitong com 48028770 lFw
c 73 254 131 184 hsd1 wa comcast net 76482991 7zb
denveraccidentlawyers com 93945252 WDl saltgar tumblr com 78313041 u1R
frenchopen karlsruhe de 55816732 1HI
blu2357 tumblr com 60154460 aL0 grlevelx com 41631122 sz1
thefunfamily com 57131809 daI
pool 96 250 237 227 nycmny fios verizon net 087409689 dj1 dyyueyi com 04578359 SEH
sups de 074037803 aFU
c 67 180 134 117 hsd1 ca comcast net 073749791 cJU sarahoswinoswald tumblr com 044209345 mPU
mrjacques canalblog com 021350712 3xf
dynamic 095 116 126 073 95 116 pool telefonica de 064637834 rX0 hsi kbw 091 089 132 179 hsi2 kabel badenwuerttemberg de 075851059 icY
cynthiadreemanmeyer com 050834399 bHb
animalcut de 44118026 RKg
adsl 068 157 149 214 sip asm bellsouth net 25849553 bDu
ns1 gfgc com 97150210 cex
cpe 174 98 156 77 ma res rr com 61571994 Nlp
ashleypictures net 28947060 263
mx johnknowlesbuilders com a emailconfig com 8527343 uM9
ou4zvz7d 1718qq com 55076239 gZT
bxbcjgq zhonglian96 com 47579149 bG8
spres ihcantabria com 82903673 Jii
c 73 163 177 167 hsd1 md comcast net 55552055 bY5
adsl 75 22 83 231 dsl irvnca sbcglobal net 66762224 wl8
mx preisguenstige neuwagen de 47567017 17W
dangellerhomeseller com 88540999 Jfc
thinknut net 78621999 tmZ
globalsolutionsng com 19596843 frS
125 red 83 34 68 dynamicip rima tde net 2623038 olS
2o02remade deactivated20180914 tumblr com 61200165 zhg
c 174 55 252 179 hsd1 pa comcast net 56430513 ruG
inglesera blogspot com 84106017 z25
6079428532 gt thailand com 41993635 UqQ
nnachat1 skyrock com 40469128 KP0
collectioninfo com 45142419 fcy
kingazkanew blogspot com 36424048 Tm2
einfach autos mieten de 64018194 UqB
c 67 172 207 44 hsd1 va comcast net 868717 5ES
partnervermittlung bremen de 12942514 XCP
59 126 232 3 hinet ip hinet net 43657778 BAs
unecleaning com 19497974 rHi
gassigassi net 52647627 Y4j
website domino blogspot com 79509151 0QX
pool 72 82 215 192 cmdnnj east verizon net 97483463 vTw
hellosaudavel blogspot com 65066192 6DF
pool 108 21 103 29 nycmny fios verizon net 67501156 oYF
tri selan blogspot com 96711552 LXm
leefoust blogspot com 67675597 x2f
i528c3eef versanet de 5714814 IqV
entrenosotrasuyuyuy blogspot com 12603161 Os1
pc 167 236 83 200 cm vtr net 7956676 igG
zj pilot com 20677146 QaM
c 24 18 130 65 hsd1 wa comcast net 92511109 ulX
yuyingliluoxuanlegangsi vvvqqq com 56648299 7D2
x4e378a44 dyn telefonica de 14438854 X3c
nondot net 38970863 mE7
ziibear blog tumblr com 59059907 TWe
primx elcokunststoffe fhd de 98194464 f4E
mail rvotes com 95604129 fTk ip72 204 76 115 fv ks cox net 97693978 FWV
h27 41 117 75 dynamic ip windstream net 19650118 kmn
dunno ytmnd com 77634308 QOV seomomma com 30397733 VDv
estevamteam blogspot com 74059213 2CL
activista de 60807562 Ndg inbound allaboutwomenscare com netsolmail net 52201907 XbZ
wlnnwz jobones com 99974047 IhR
zimmermann diamantbohr de 54584109 yN5 c 24 10 23 190 hsd1 ca comcast net 85155213 Nyp
girls33 com 63935466 caS
xn steinbck emb 9ib de 90934349 zSa plessy com 34812885 49s
higginsweb com 85982579 2AH
unidevllc com 73433876 nVR southarabia net 91490352 3g4
weinhof karrer de 98766756 4jI
ip67 90 19 85 z19 90 67 customer algx net 92722552 u4Q rigenser files wordpress com 32442244 9z0
75 166 20 93 hlrn qwest net 41032961 J4B
pool 151 202 107 40 ny325 east verizon net 94649214 ZyE cpe 76 184 125 231 tx res rr com 47489165 Ks1
ool 4579d9a8 dyn optonline net 34796267 bHH
p4fdf054f dip0 t ipconnect de 46827582 TMF mail fil edu com 56051763 UEW
bibver de 10136006 fw7
picopod com 074442049 6HV fliesen gz de 010351525 fSD
cpc88373 newc19 2 0 cust909 16 2 cable virginm net 04899693 iPK
rakshusketches wordpress com 05540694 zrR kou20071013 ti da net 085027079 ApU
dslb 088 068 100 131 088 068 pools vodafone ip de 041404567 yWC
tracyreneestreasures com 053291499 YDE c 71 235 152 219 hsd1 ma comcast net 040884505 QYQ
ro wesem com 055501795 mGa
183 sub 75 236 40 myvzw com 86284160 90m x4e35d8b2 dyn telefonica de 24772090 wZu
97e71c99 skybroadband com 87219376 BTc
w5s china ichemical com 53364627 7Vj wakandanjoon tumblr com 63350754 qkr
x5d838406 dyn telefonica de 48011486 WCA
144 34 140 151 16clouds com 75913527 xl5 186 92 129 149 genericrev cantv net 52110006 rtT
fon45 1 78 229 113 18 fbx proxad net 87343566 O2Z
83 93 39 153 cable dk customer tdc net 96623715 tmw pool 98 114 223 148 phlapa fios verizon net 28691964 jKT
104 189 10 64 lightspeed irvnca sbcglobal net 79709953 Jib
rainyaye pixnet net 79707254 D66 babiesearrings com 50214453 T2i
chambre agriculture36 concertationpublique net 89237635 K35
pool 71 163 62 167 washdc east verizon net 47609908 yD1 ip70 171 190 151 om om cox net 50188787 Zcp
rappattawriters blogspot com 8738075 HOu
adsl 99 150 2 230 dsl chcgil sbcglobal net 82209918 20k ulrikheltoft net 85886582 iuf
fehlurteil de 35202322 VqU
centerstagemall com 18488305 hJ6 ip70 181 241 6 sd sd cox net 47336306 9dY
p54b58b90 dip0 t ipconnect de 33659782 w0N
dslb 088 076 070 173 088 076 pools vodafone ip de 69692909 Rcf ip68 229 67 1 ri ri cox net 93706706 0BX
pool 100 11 81 5 phlapa fios verizon net 43625660 Yzb
89 212 133 225 static t 2 net 086487395 Mhr ns1 ibiztracking com 087360834 Qj5
angelsofdarkness activebb net 024386872 xpz
adsl 074 182 138 231 sip sav bellsouth net 022594146 w52 teletekstmissers blogspot com 092630379 lay
w008a04f kasserver com 066629551 d7I
express1095a com 035794476 DQu northandaway com 095700535 pZa
zooting com 069073091 ulM
amrut de 92630005 rVX isaviel tumblr com 80606670 UnK
1800sofas com 76678333 roU
mail andreas sept de 73237070 DKv bielefelder altenheime de 65709032 5fz
zyxrk3ibm9r hatenablog com 8714516 DX5
chinapapernet net 14884891 nNq ool 18b8b2c0 dyn optonline net 21445852 qHS
solentmanufacturing com 90134282 6fL
pauperspublishing com 91201087 BCW ns2 hispadns com 89234522 Q5U
p57ada3c0 dip0 t ipconnect de 11649880 cQB
feol net 42510163 1T3 thisrestlessheart com 77066856 UI5
theguys who blog tumblr com 74214556 nCy
techno2net blogspot de 76541932 VIv larrygard net 53528167 bWJ
punypixel com 60474051 VWQ
p508208e6 dip0 t ipconnect de 71953896 Aox findthecbb com 80323199 FC7
osinsights com 40315661 pCS
florenceintimberridge blogspot com 55505612 7Vf host 61 70 171 106 static kbtelecom net 31170763 B7c
eggokid tumblr com 79201402 vng
c56it ferienwohnunginrom com 15558745 hwK rohnacher net 94382830 l5O
pd9e8150e dip0 t ipconnect de 53895236 2TP
azamiothman blogspot com 082105914 pXa bluecelebs tripod com 040911793 Hv5
romantik forum de 042951816 0FC
artepaubrasil blogspot com 045461278 64y iiabsandiego com 093956266 3sQ
weddingdressbargains com 031104628 pah
p3ee01221 dip0 t ipconnect de 057753719 Bsq 1770436 free press release com 037849850 lcm
dslb 084 056 016 107 084 056 pools vodafone ip de 095734664 YXD
aartesamineira blogspot com 635578 bRw jol13 5 83 156 125 22 fbx proxad net 2328416 AK3
jiaopingzongjianji sssrrr com 28372729 O5R
thingsthatineedtoshowmywifelater tumblr com 57780210 EGk saltyfig com 98491372 gCu
senfmuehle de 83634377 nSy
mail pianisten net 66956913 bM2 chivu mihai blogspot com 60771882 nof
505 l tumblr com 79590074 cA3
aberens de 48836176 4X4 i577b78ea versanet de 78034499 9px
chem241transcripts blogspot com 72030250 6BN
sabenanas tumblr com 1217141 UAp fotobox mmproducts de 75322445 os8
1356421 fentishebei com 96672331 dcK
c 73 62 158 32 hsd1 mn comcast net 48518591 0cU static 72 90 225 223 nwrknj east verizon net 62851492 aVb
mmob2c com 67053085 vd6
griffinynjs357150 digiblogbox com 13916023 IKv x4db49435 dyn telefonica de 77818646 knA
schumacher frank de 50706889 LvS
unmounts worddetector com 52244620 MMD jasonwordie com 72900301 Dd8
3floor tumblr com 39322378 yjp
curlywurly113 tumblr com 9994725 RA5 pool 96 224 96 144 nycmny east verizon net 43246372 MT2
volkerschnabel de 71900476 spR
adsl 64 168 114 25 dsl anhm01 pacbell net 067525942 ZP4 fulltimefashion com 041165970 wZ7
cmajorfestival com 023817375 rji
hybrid1987 1 fr ns planethoster net 068383892 o1P michelbougny canalblog com 064918886 PB7
lesrubansdemarionnette com 02706761 KSw
156 red 88 12 211 dynamicip rima tde net 045511830 xjI sanweijianmozhizuo vvvqqq com 076716385 K02
mail durukanduru com 040226160 olu
ibis sarcelles com 20434221 LUy bnvproducciones com 90564238 UyG
xn akkubrse r4a de 81553447 O3z
94 54 9 109 rev sfr net 47055149 x0J mail municipaldemairena com 80743687 J8k
asianfootwear com 38937387 xeJ
empos de 93514032 zuE groovetechknives com 92514106 kLT
clovernyan tumblr com 24168262 Tox
medicaltraveljobs com 13505837 BLI 1 sq tumblr com 28858812 xYB
junlq longxin888 com 72070140 a8h
oepnv essen de 11693150 LKJ manateecountyclerkofcourt com 27809929 voH
fa resh tumblr com 46274945 aRp
microcraft wpengine com 88768005 K5x adsl 75 16 97 8 dsl crchtx sbcglobal net 71679083 UYv
lexetline63 canalblog com 99059119 qG2
cme8000 com 96112657 t8B gmulmedical com 2547894 4OC
b4f00ce8 linkbucks com 18962380 Yf3
b bulgakova tumblr com 96478815 C5j bigdadda com 21749015 BEd
jazzcomics blogspot com 18243189 H0f
musikertankstelle de 73944926 9s0 extranet edtec net 49817434 xkW
suzancascianoworld blog tumblr com 52941116 y1G
fanfan118 tumblr com 082113178 ig1 ge 4 20 ur01 spokane wa spokane comcast net 036631264 9Gl
sg1306 de 097446631 VQT
c 24 10 175 49 hsd1 ut comcast net 066330620 vjX c 71 62 207 217 hsd1 va comcast net 044007929 Dp0
70 244 52 71 lightspeed livnmi sbcglobal net 079224674 CIK
vqguefics tumblr com 062387698 jaE 75 30 131 24 lightspeed arlhil sbcglobal net 033054659 RGD
madelia ocm 56 13 cccinternet net 045418376 uyr
adsl 99 129 19 77 dsl rcsntx sbcglobal net 6771270 E71 freshassessment com 84061757 pOa
aussieallyyy tumblr com 3937200 2cP
poolhockey08 1fr1 net 14268480 hCg host 89 243 109 65 as13285 net 76335 3zv
rclee net mail protection outlook com 34887191 1fs
lifepda com 90458710 Fdt ppp 70 252 133 133 dsl ksc2mo swbell net 21677417 Ngo
creepycrawlythings tumblr com 87960171 rPS
ip68 105 100 67 sd sd cox net 34764843 AVk mail thetreeloft com 17195820 PHK
walliis30 de 35370699 Vba
johannestrautwein de 22397054 KWe 24 228 127 78 rev sfr net 868990 ULx
pool 96 247 228 134 snloca dsl w verizon net 50103788 ugQ
shzm luosi com 8747822 5pt bmg64 tripod com 62257832 y8z
primary 1 test papers soft32download com 71584631 eHJ
rogerhodgson com 94556037 gVk c 73 5 8 224 hsd1 tn comcast net 24354629 hxS
c 69 140 75 41 hsd1 md comcast net 68089420 M31
marcus imbsweiler de 83287563 5PN by mo com 83749123 fVK
jk2q com 25049592 hx0
claudiairene tumblr com 26096408 Hly 129 214 205 35 bc googleusercontent com 13448259 i8t
hausmeisterservice schlottag de 45558344 EgM
g7cxv sanjianglive com 077594616 OsJ brotherxii tumblr com 010522417 jZ0
cpe 98 14 92 148 nyc res rr com 045428279 lqU
tvmagictricks com 076900706 JkF c 73 168 148 84 hsd1 in comcast net 092407499 qwQ
bgrewards com 078424638 grs
pool 72 95 35 214 hrbgpa east verizon net 038876874 0uC guesswhoimet com 047635338 6lm
ns1 denizhost net 062129866 O39
188 181 226 5 dynamic dk customer tdc net 37351495 acO pcbeachvacation com 56093325 RuQ
nflorczak wixsite com 9020689 pCT
m alajmii tumblr com 65457637 dxm gb188 com 33604761 fjU
ecole de shiatsu com 8746410 ERT
gdanimation com 14543892 Gw2 reecenet de 70300850 qBr
degreeforum net 74139513 YYm
75 121 178 160 dyn centurytel net 56036528 IvE groovymail com 46052343 K9z
verizonnetwork net 67995965 Ef2
adelais de 10674776 yqa hausprint de 75612767 XZC
moertelshop com 8051505 COG
maerkischerhof de 51831816 Udb 208 89 165 83 dynamic reverse mundo r com 34246260 h39
mail dieduesseldorfer de 78033851 eDA
static 46 43 226 77 ipcom comunitel net 94088137 Bd6 psychedelisdrugs com 45436713 teT
kearth com 27233560 uwK
hanke09 tumblr com 28730433 5zD excitebook com 58686853 R6y
ip 97 74 130 242 ip secureserver net 48960985 htl
pauloquerido net 63183508 nCj mobile 166 136 232 023 mycingular net 55042099 OJd
p4fdc97b3 dip0 t ipconnect de 28983723 hEk
ec2 18 185 2 6 eu central 1 compute amazonaws com 09559058 l35 bestcookwarely com 056680617 4LI
82 65 157 165 subs proxad net 039865103 SOl
c 67 163 221 50 hsd1 pa comcast net 07759940 Nno chasehasit com 020299876 UNK
mavenshosting com 051225266 Zeu
adsl 69 212 18 136 dsl milwwi ameritech net 016930155 hAH xdsl 81 173 141 95 nc de 0658982 Y2s
anatoliacarpets com 034320331 TbQ
luegger com 38528759 a0C breastenlargementsupplements com 2239205 oMn
countryjoe wordpress com 37252940 Zmt
sandronazireu com 72544027 7Bj wirsprechenonline files wordpress com 72954420 jfh
inbound imamax com netsolmail net 68329170 VoN
ip 178 201 125 171 hsi08 unitymediagroup de 332260 Q5E cpe 71 77 14 170 nc res rr com 95497684 4rz
207 192 224 121 com sta suddenlink net 63897575 mFf
cpc124672 birk9 2 0 cust300 1 3 cable virginm net 78532076 3Ez innenarchitekt karlsruhe de 79252021 fBc
noithatkhonggianviet net 2636619 q2q
fcdgk com 80480171 ZPc mxout147 b214 edsend net 85273933 7GU
108 253 101 105 lightspeed tukrga sbcglobal net 25629167 440
bouabjian com 46557809 8bR ip5b432c27 dynamic kabel deutschland de 15398064 avu
live vm240 hosting 1xinternet de 87732021 9l9
ogeneo com 87874588 uHm 25 14 206 77 rev sfr net 98282224 EXf
midnighthot com 35940269 9qg
adsl 68 88 15 23 dsl hstntx swbell net 67915245 tKR webseiten grafik de 62600553 kVl
74 198 113 92 pool ukrtel net 86859200 sKB
a95 100 155 24 deploy static akamaitechnologies com 36345817 VOx 60 sub 75 251 66 myvzw com 45381199 uSD
pool 71 188 25 113 cmdnnj east verizon net 17123974 yw8
us5gbo 360hometulsa com 08664415 tfs winkelmann schmidt de 066816372 vCP
mlone com 040189230 7Oc
mail tanzen in ludwigshafen de 091060449 nHE catodesign de 089153006 Ccu
mta 70 93 189 81 socal rr com 049652380 uKy
hostmaster csu gundelsheim de 02416884 4RD pc jessesoffice com 087517003 llh
djbd8l fupapa88 com 070850219 IBV
cpe 104 174 183 69 socal res rr com 99400803 12L takken text net 48339910 oJr
reeseruland blogspot com 9996155 ypH
rehbermerkezi com 44590965 6ij maci lent tumblr com 97403462 k52
coveredcollections com 24675399 ulm
trigon business intelligence de 53900148 YS7 ppp 70 250 213 8 dsl spfdmo swbell net 14209575 oDD
ucuzkitaplar com 41654556 fTP
teetroit com 89330407 HaG xiepanzhusaiyasuojiqibeng sssrrr com 42704892 aSs
softbank060105136176 bbtec net 71353280 ou6
cpe 104 35 54 65 socal res rr com 27762105 hto carl bethge de 6144866 Knm
82 198 41 213 dyn user ono com 8441561 tNP
pool 96 244 80 56 bltmmd fios verizon net 23539040 AwA ask futurekarl tumblr com 41515369 VB5
myfamilymission com 5140915 8jV
adsl 69 227 165 182 dsl irvnca pacbell net 39346210 JTF 28 sub 75 198 214 myvzw com 90439353 HSG
mx viewsmithhomes com 14246003 xC7
23 31 213 198 static hfc comcastbusiness net 74880474 2D5 642717 sssrrr com 57284606 RGn
cpe 24 242 120 222 elp res rr com 7245244 9R5
monika wirth de 65029959 D8a abhaedu com 54112653 q0D
mail2 stetinger de 65393365 7bx
64 90 169 120 static nyinternet net 062465996 QPI svxvuad pxmining com 087521943 RGm
neverbackpain com 090368801 lEL
larsen088 skyrock com 010997220 Uxn h46 209 40 69 dynamic ip windstream net 016337895 KGV
wsip 72 214 38 10 no no cox net 060653772 1kI
broadviewholding de 098453865 efn ipservice 092 218 251 237 092 218 pools vodafone ip de 042776577 1kF
codekev tumblr com 063061718 7NY
pendef com 70281303 4sX 5zwx com 66179612 L1r
elderhawkins blogspot com 99996629 8wd
bernds fotos de 50230929 PUd hanningtontame com 9231998 xPM
oh 71 51 115 104 dhcp embarqhsd net 56114352 jRm
peizhongleipeijianzhujian vvvqqq com 22632523 7Xh eventsbycarlos com 29141954 Kvn
172 97 189 110 cpe distributel net 57641670 X9l
32 sub 70 211 106 myvzw com 15735219 HQV dr meri de 78367860 ZXK
p5dcc582d dip0 t ipconnect de 22505444 db3
h49 33 96 216 dynamic ip windstream net 18021787 E85 b000umlx5y seasonbuy com 69546795 smi
16448758 en frbiz com 72392100 43E
jwlcs com 61478192 P10 jeansmall augsburg de 14416096 Jmu
cpe 31 15 238 55 cable telemach net 9349847 x3a
mail re ticket com 33048254 aYA h81 de 24592496 mAP
brennnesseln im arsch amateurin com 73211321 Jrc
lonestarmedia net 97911373 dNc cpe 76 175 136 210 socal res rr com 20873220 3nz
ideaworthy com 45062244 bdf
gpgcorporation com 31732099 IeT cnbeyond net 75653410 7gf
moon cafe livejournal com 43876614 vZz
thesarusawablog com 096111492 C6L theartofstuffingyourface tumblr com 059790614 opr
ly4207 com 078769001 GIw
riskadvisory calimerepoint com 047040521 oPV j5508 qiantibao com 019902657 kcQ
f8085 com 066186479 Qc6
queerfood com 040784246 Gfk c 71 56 232 170 hsd1 co comcast net 097178460 SIY
dslb 188 101 217 181 188 101 pools vodafone ip de 043784539 Pa1
78 137 28 133 dynamic ppp pool 2mcl com 72473828 5LT 2tex de 15308470 FwD
liveyourfear tumblr com 75221914 aeV
h184 61 152 26 lncswi dedicated static tds net 97608290 39Q galveston cheaphotelsandmotels com 68070611 yFP
yoly de 38782035 Edf
252 red 88 7 246 staticip rima tde net 65188221 23h verdespatial com 61513643 WNi
bumblesgroovycrochet wordpress com 48633278 CUd
kedermawanansosial com 87844360 Oil purusha net 11369618 2mc
ai4 lnhengrui com 5580481 uz5
33tbv sanjianglive com 77163510 qP7 77wdw com 65225624 2XY
khs plasmax de 75188656 sy1
saschafritz de 48128553 x1q ool 44c76eea dyn optonline net 97475378 RYr
be wolfmedien de 2740763 zaQ
unscriptedheart com mail protection outlook com 23175911 z4l sturbridgevillager com 71341686 qp8
c 73 19 23 251 hsd1 wa comcast net 17633701 tEM
ixempra de 72834215 60T x5f70778d dyn telefonica de 39446506 GKj
10thstreet fancorps com 20857065 LUK
oo2nt710 c2037 com 16443063 U1Z dslb 178 002 232 245 178 002 pools vodafone ip de 31729002 Rq8
ebonyteenager com 63420708 OUy
l a r s tumblr com 029311447 cOv qualitycollectivepeach tumblr com 037130732 2PH
lasfotosdejoseantonio blogspot com 0524702 JXs
santonius de 067211434 OLA tischlein deck dich kreischa de 050505653 K6a
phoenixharvest com01i mail protection outlook com 016481885 JNR
materialpoetry com 064359316 yrT gosolarnewyork com 061834594 HE9
gmakemoney com 037217073 3um
vancouverlv blogspot com 89694454 3vD lowkeylawely blog tumblr com 16769252 0jK
i59f601d0 versanet de 5272017 EuP
216 67 43 40 radius dynamic acsalaska net 48653060 WNT d75 158 30 188 abhsia telus net 66111340 QCa
nicatnecef blogspot com 31323479 2re
dslb 178 009 050 104 178 009 pools vodafone ip de 54368566 RSi 21gis177 gulftel com 69421119 B6S
kuhdorfinferno de 97517769 8k2
76 97 92 62 static cust telenor com 38311848 iH1 queenslandtiles com 83024967 4Dj
annesminiatyrer wordpress com 70953475 LwA
feijiuwupinshougongzhizuoqiche sssrrr com 92988872 i3c 113 10 25 109 rev sfr net 42133373 FIO
78 69 234 192 no75 tbcn telia com 72288842 UHT
adsl 76 199 90 101 dsl wlfrct sbcglobal net 56614110 pdX adarlan sass assin blog tumblr com 97279515 10S
blindsexdate com 29657145 P4d
n044s130 bbr1 shentel net 10329678 dlb flowerpot net 31888813 6Sb
c 68 33 99 60 hsd1 md comcast net 87216847 veK
spill words not tea tumblr com 79728498 Mbc cpe 74 73 52 58 nyc res rr com 94316245 1XX
msar de 76963221 eia
mail vrhgn com 97667956 rsz searchengineninja com 53358714 JUl
obcq com 69144679 8Se
softbank060125218124 bbtec net 1435256 FDt guahao com 30258112 7rc
ipusk ru0c mail eo outlook com 39082206 j53
runkku net 90430178 lOS owl hermann foettinger de 3293151 z6u
ssep communityhost de 62456916 GU8
p5dd19574 dip0 t ipconnect de 43688655 UeS zillionauctionsiteofkrazykelvin blogspot com 5944638 irn
lucchetta de 17272071 3pE
best dinner recipes com 87339548 wFg c 67 167 107 174 hsd1 in comcast net 15579853 BUv
c 69 245 203 250 hsd1 il comcast net 62015209 AJf
nielskyy tumblr com 78269804 HxE forward1 garantiserver com 51172673 OV3
immoapp net 14509828 yng
pool 71 255 168 12 bstnma east verizon net 99319837 HKV nigelprentice com 22221124 zga
miniaturepatrolloveruniversity tumblr com 31098914 UWZ
spywareandadware ironcladbyte blogspot com 45105477 zBH sat7 wordpress com 71277675 tlY
a88 221 150 24 deploy akamaitechnologies com 49775344 xCv
unser seifriedsburg de 13996472 SlT alexanderhughes de 32553962 7vQ
c 24 63 169 223 hsd1 ma comcast net 47324888 TXm
xccrazy blog tumblr com 61945814 6Ec wingrabuilds com s8b1 psmtp com 28032797 jmu
topcitystrengthbias blogspot com 85602826 YEB
present pingpangtang com 076060136 Pqw 164 red 83 49 195 dynamicip rima tde net 015659668 Qfa
ip 178 202 234 247 hsi09 unitymediagroup de 022694169 KRJ
goldmetalservice com 073763680 5kQ 61 229 228 213 hinet ip hinet net 080433292 aWo
083264 com 019921343 nEW
artes theaterplastik de 018039476 pf1 hotelsegredosdevalemanso com 027916675 BcH
homolongevus com 085351224 MrD
p4fc4a570 dip0 t ipconnect de 1901175 tUf pd9e71c54 dip0 t ipconnect de 9491523 Fgg
p54beb678 dip0 t ipconnect de 19216300 mIz
ip70 161 15 100 hr hr cox net 78511968 tvM boathouse restaurant com 5391086 EWn
ciutatdeleslletres com 51744301 PBw
blaaarg com 11964775 dVB stylovy0 blog tumblr com 71355267 Veu
backlinksforyou com 27769228 VJi
lrom de 58674960 GHL mx1 items web de 31674088 tzQ
76 244 169 227 lightspeed wepbfl sbcglobal net 9997083 RAO
kcmostwanted com 70325097 ig4 aundou 4 bbs fc2 com 21927473 XU2
3345go com 98571030 Ac0
rinnnchan tumblr com 54658754 zgI 72 161 46 20 dyn centurytel net 34246728 YZY
marianoleigh tumblr com 14826819 co2
hsi kbw 095 208 080 141 hsi5 kabel badenwuerttemberg de 48363797 YSd c 73 59 166 228 hsd1 tn comcast net 14800685 93L
moebelkistehavighorst de 7538747 gwZ
nsc209 177 223 50 newsouth net 30663327 n76 hofladenonline de 95492169 CoH
102 red 95 120 85 dynamicip rima tde net 68625914 c23
librarykredig wordpress com 83404007 d6L shoudongdianguijiaoji vvvqqq com 73798185 zuq
adsl 99 49 20 128 dsl rcsntx sbcglobal net 2952829 uHP
tunedintokyo com 088667752 rYa publicdirect com 038406227 q8t
worrichs de 066131679 ywz
quickpaycards com 040235207 Aix pd9e8a2aa dip0 t ipconnect de 018149534 Ays
184 15 182 227 dsl2 chtn wv frontiernet net 09849552 170
windvale tumblr com 03537054 tEs lb badhersfeld ms internet filiale net 044198753 SyF
maduskh tumblr com 067707871 5Tg
variotrade ch mail protection outlook com 29181861 fXZ pool 98 115 194 8 phlapa east verizon net 68537333 XiS
hybndy diytrade com 27804564 euQ
ppp 93 104 67 167 dynamic mnet online de 30350327 Fhf camilaflowers net 51243629 UfT
citybamk com 7599846 NJv
action network com 37356074 YsX autohaus meissner de 7715726 gPO
danieladgonzalez blogspot com 72320405 Uxk
harvey8ep4x tumblr com 1064572 CmN genoproteau com 85461189 QJD
freemusic7 blogspot com 48943109 hVK
75 174 216 35 phnx qwest net 54112104 bGM ec2 54 66 158 109 ap southeast 2 compute amazonaws com 90704403 ZOO
theluxuryyachts com 35739904 E19
cache1 jerky net 67132441 XSQ jmrmovers com 37685412 rG3
adsl 5 198 16 11 karoo kcom com 29874156 I37
morrow vemma com 10758543 1qB adsl 99 139 127 44 dsl emhril sbcglobal net 55842632 WNK
sabiduriaysalud com 48762285 nHU
dslb 092 077 053 147 092 077 pools vodafone ip de 3814197 RAI ns2 c36809 sgvps net 93711344 bwm
askican com 63519287 4ba
tecnolollls blogspot com 35542807 Atf pool 96 232 247 121 nycmny east verizon net 51179047 KHL
sinpasaportes files wordpress com 12199433 u1j
c 76 118 159 242 hsd1 nh comcast net 056760931 CqW musika ucoz de 026722005 gaT
eleculator net 01714217 oot
joannecklein com 063425104 QRw vivo10 viv02 com 038617330 pne
jasonbeattyre com 06039218 IYe
edwalkerracing com 064815415 1oQ 19 214 68 216 ded dsl fuse net 092021526 kf8
mail deeepunderground com 025058507 BaD
x5f76366c dyn telefonica de 17595256 x4P 5bdt com 81849614 eFc
b globe com 72709091 uzC
mail suncontainer com 49879872 XRf happymate com 53107341 0Er
canada prime seekerific com 18324050 6IO
very unfortunate tumblr com 13488257 NMO p548212b4 dip0 t ipconnect de 95428519 aIj
midiacega blogspot com 52506579 Skh
jaine de 9720410 OE1 lepstudios blogspot com 77382127 3WY
directorygift com 18713518 Q4m
helga gnocci de 7473585 Dur glisters com 50793224 i0Y
qasehqaleef blogspot com 79226933 xzz
chucklesstores com 92320631 JlL emanem1 com 47743486 epm
r nba com 5884637 XPQ
p549278d0 dip0 t ipconnect de 963366 pjC yblfyz fanhualiaoning com 8964000 0yZ
cpe 45 36 82 220 triad res rr com 56499142 UWd
fresnoforrent com 31808992 ZRS wrkemp com 69684227 zgt
p4fe958f2 dip0 t ipconnect de 3105522 x7J
alittle2theleft com 28405514 M1b insin cere tumblr com 7520827 lfd
wakenitz schiffahrt quandt de 80488325 54E
cpe 24 26 54 156 mi res rr com 045153097 lHY alitretinoin de 031372631 OJf
dslb 178 002 227 185 178 002 pools vodafone ip de 050656069 1Oi
rugbyarchive com 038317687 DKd cpc139738 pnth3 2 0 cust114 5 2 cable virginm net 067871796 b5v
ontimecelebrations com 094560978 rtQ
tenolimi01 gw customer uk uu net 0206697 XFY laqekq scroonch com 032928514 9S3
greatgatsby69 tumblr com 012965281 vtf
23 93 60 190 dsl dynamic sonic net 47731253 oxx cpc106216 gate11 2 0 cust76 16 2 cable virginm net 16651926 209
h217 7 96 216 dynamic ip windstream net 13107865 pNf
ilhousegop109 nationbuilder com 23295819 PE9 p54aa1b29 dip0 t ipconnect de 5881204 xfQ
ip68 97 35 224 ok ok cox net 28804343 pfh
helijetsolutions com 6710486 Msi c 76 114 92 46 hsd1 tn comcast net 10266542 ua1
49 226 131 77 rev sfr net 17046009 SwT
p4fd2b641 dip0 t ipconnect de 13238445 2ul dipluridae de 66663183 pSG
c 66 30 159 154 hsd1 ma comcast net 28918626 XVy
sarahxll tumblr com 51588930 IRt seantv com 90508062 38b
pool 71 123 245 60 dllstx fios verizon net 19633815 eX3
madeinfranceantiques com 81828218 VH6 oakvillegalleries z2systems com 63545038 wsK
icelandicmagnetics com 30584133 Zxx
silentshen pixnet net 81377244 cjG pool 71 170 187 199 dllstx fios verizon net 3714467 WgC
0543cfa9 skybroadband com 72743393 yAF
c 73 232 133 228 hsd1 tx comcast net 60293404 fQl rose petal puppy tumblr com 44001551 QsL
thorfinn scubalinx com 47167671 sKY
s205 206 59 82 ab hsia telus net 46896791 BDJ p5480afd9 dip0 t ipconnect de 89565791 73f
ip 203 4 71 77 varnalan net 49030507 6MY
jiaer1 vvvqqq com 059943540 7hS p5b1544ab dip0 t ipconnect de 055022548 VbN
36 237 213 62 dynamic ip hinet net 047896623 WBa
altenburger akkordeonorchester de 034096216 uIe wotkinz987 newgrounds com 070806851 shS
dvc 67 220 156 186 movil vtr net 038263869 3Rh
adsl 69 228 88 145 dsl pltn13 pacbell net 085608571 oGM adsl 99 163 131 179 dsl hstntx sbcglobal net 054960060 pmX
liquascent com 075488507 J1N
dhpg duesseldorf de 98165756 rGM vailcam com 84990630 PQ3
stevehoisington net 91538476 LKs
natoma com 11076003 wLd 218 171 165 82 dynamic hinet net 71204317 b7B
explicitseth tumblr com 77347187 kxd
marcmitter de 70503707 pW0 dateogato com 16250491 oz2
71 214 31 249 omah qwest net 67745786 75Q
pool 96 252 170 143 tampfl fios verizon net 55756292 uXs thesonofdeath tumblr com 94390837 rKp
larabikes com 2161326 WrQ
pool 108 21 0 52 nycmny east verizon net 19173213 68E midwesttimer net 91651779 A62
pool 98 113 168 9 nycmny fios verizon net 11481659 met
158 sub 166 159 251 myvzw com 65800576 SxF michijih tumblr com 14714588 mvn
jezus leeft blogspot com 88365574 8ts
jiansujigangchangyong vvvqqq com 90308963 Z6j c 76 119 194 151 hsd1 nh comcast net 94686480 OEf
bxbygirltears tumblr com 72589160 qfU
s72 38 249 252 static datacom cgocable net 8635947 XoV p4fe64fa3 dip0 t ipconnect de 1692767 Nox
hirsch seebach de 144632 ZXT
jdsexpressions com 61928074 diW con5tantrand0mm0ti0n blogspot com 25751530 nah
thefabulousfridge com 13519248 VAj
spielzeughit com 081787180 MCT p508fc0e4 dip0 t ipconnect de 080465002 rUq
finger tidesec net 039150167 1mi
cheerlaeder thumbs abartigundgeil com 086718767 iU4 132 red 88 27 132 staticip rima tde net 039545048 a1I
mail projectflamingo com 039309050 26M
vm01 africarace com 043237984 Af9 bonesinbreath tumblr com 096338519 pRP
xiaoni0905 blogspot com 076429767 8zR
bulgars wordover com 42170529 CB6 sivale com 45788949 7Kf
driveshack com 63762740 PvW
sciencejohor com 94185113 pw8 124 224 225 89 dsl completel net 99907420 V95
71 211 166 200 hlrn qwest net 64526766 aTW
lowsbuben de 8744213 GgQ sheepdonthowl insanejournal com 83529280 uJW
is mbmbam420 out yet tumblr com 82867667 Ab1
ideaprint net 36381554 O29 atravesdasmentiras tumblr com 21440823 NiU
27 red 79 156 143 staticip rima tde net 84920152 YP6
thepotmaster com 68335908 Jyj adsl 99 157 93 185 dsl covlil sbcglobal net 75496223 loZ
heideperle stroesswitz de 17718681 VDR
a96 6 241 137 deploy static akamaitechnologies com 71096752 1xn c 71 225 105 153 hsd1 pa comcast net 92813849 hKc
218 174 200 110 dynamic hinet net 71544577 Jpx
postdoctorals net 34568552 Sc3 wildgirlfriends com 83318038 Dgw
pool 96 255 23 164 washdc fios verizon net 74362312 pPg
wardaviation com 46973904 wzW p5b121ced dip0 t ipconnect de 80023387 mal
thruthemirror blogspot com 68971489 4XR
mtsgamesaman com 62752183 Rwf 51appstore com 24420583 vdc
123 red 83 35 123 dynamicip rima tde net 34463595 a6y
p5b09ac71 dip0 t ipconnect de 015744687 715 thehollopeters com 093096920 K7U
mail kotters com 054521101 pXb
p57affc43 dip0 t ipconnect de 011998974 R8G volunteeringinaustralia com 048147941 vtl
rebuildu com 064843748 S5w
adsl 75 58 174 230 dsl irvnca sbcglobal net 044851931 GoK galanegrello tumblr com 049440046 b4Z
developerslane com 053061484 Uhq
153 phx dedicated link3 net 40861235 loI cpe 45 46 245 124 rochester res rr com 58142164 pf0
hostmaster mountainlavender com 25306994 T2B
stoffetiketten de 35259505 hlm vnickolova wordpress com 21750494 YNi
pace rz de 10223119 Qq2
131 red 81 40 169 staticip rima tde net 5538072 hmq cpe 85 10 2 86 dynamic amis net 55249325 EWH
098 121 219 093 res spectrum com 41092238 vP7
c 24 5 240 246 hsd1 ca comcast net 13546213 vtT metal oxyde blogspot com 296355 YA7
c 98 255 82 22 hsd1 ca comcast net 90490048 G2z
ool 45739314 dyn optonline net 11518717 ooQ kushirokita net 32499156 8o6
host81 149 243 112 in addr btopenworld com 14263914 uHG
h212 98 135 98 ip windstream net 15485800 NeT taxi guillium de 34463201 XZE
ifahed net 42956162 Bs7
fdxfx sanjianglive com 44840945 XyP johncena2743 skyrock com 93364058 Pm7
pmzeta tumblr com 38301507 uSl
softbank220004046131 bbtec net 94586424 GCG 34 red 83 50 149 dynamicip rima tde net 21204276 SMs
c 75 65 51 18 hsd1 tn comcast net 920230 VOF
pt bmpr com 30882315 Y4r skipapple blogspot com 25983321 iuq
ktasa onefireplace com 6150011 Cag
naturhuf de 058056911 Ulb 2f7y sumav com 042434701 JbS
dailynetlife com 050370409 JDM
mx0 schmidt finance net 025467213 IP6 247 red 193 153 195 dynamicip rima tde net 02026674 sr0
sgv oberkirchen de 084889813 TOc
kids gallery com 016772628 xjc ns2 southviewchurch com 094991907 CxM
ns31143 ovh net 037433787 WdB
tierischer norden de 50347069 BGb ambienteparty de 59565867 gtD
nursing writing blogspot com 12033045 R0D
citii de 36924272 zql hotel zur gred de 30684736 WSZ
dxdaniel tumblr com 35715382 iJH
125 233 36 87 dynamic hinet net 34123518 A7N goodback de 95798068 CmT
jiajia chaotic x net 40749240 7rZ
janus hameln de 3223467 Qjv freeyourselfnow net 24798310 dsK
redmondmortgage com 46267859 aqH
edsword net 65605233 FGW mail etm sf eng net 21874178 5lO
121 red 88 27 114 staticip rima tde net 7030426 jAC
shanyl tumblr com 32190009 pWm elvis liveshow de 67118849 xOi
tn seifenkunst de 9149365 fyc
business pictures de 83993428 XI9 2ndchapter blogspot com 67631773 xJz
h153 33 20 98 dynamic ip windstream net 35913957 l88
thermaltake esp manuals com 87628938 ren c 24 22 91 203 hsd1 or comcast net 32514818 dSi
listings paragonrealtors com 17376415 DPd
pwasouthampton com 33021745 1TO daisybites blogspot com 24025260 MrM
kinkysouls com 96542633 W2H
pool 72 81 205 160 bltmmd east verizon net 037026542 hrp webmays kokoom com 015102469 tk9
halocoy blogspot com 03702118 Bwd
titzbrennstoffe de 099892928 Cvy crossroadsoftheheart com 015596592 z6F
mediawks com 036690011 sCz
0ymyd fringedownload com 067009442 DCx foriconcnm blog tumblr com 063363217 ReH
104 8 98 122 lightspeed tukrga sbcglobal net 026116002 097
hugugokeze tripod com 64235313 Bnn 92 141 79 86 rev sfr net 71989626 Xkg
oikak8 allamericanauthentication com 84962822 PJz
clicnon com 95665438 fMZ mx uni massage com 99415318 KS3
wewan net 11207231 BrD
dslb 178 004 249 240 178 004 pools vodafone ip de 54789410 91c cul brandbatteries com 67622365 pud
pool 72 81 197 82 bltmmd east verizon net 81848921 t9X
rusprint com 37167661 i5C h1 109 28 71 dynamic ip windstream net 19922112 cFh
smile death98 tumblr com 57679828 ebs
namakuroseita blogspot com 248480 uRf my upics de 86075467 P3J
minisparesuk com 11215740 1Qo
c 73 191 100 154 hsd1 md comcast net 9426134 azA jou95 1 82 233 18 92 fbx proxad net 14919493 yBv
ram jet com 20766030 UId
travisfosrt frewwebs com 25992257 9zs steuerberater cologne net 22278565 q1f
kenlamlyk xanga com 56925460 LBD
rusalkadoll tumblr com 83560559 Lr8 early brandsoundscape com 46543355 4Ro
cpe 69 207 177 123 rochester res rr com 68666932 ooq
africa deal com 73816431 sDm msam34 tumblr com 50959695 cqB
fromagerie olivier com 12720493 ugw
server 52 85 124 6 icn50 r cloudfront net 037402929 c4y whlilong com 039519189 7dH
static 70 107 125 93 nycmny east verizon net 042018471 bJI
haarstudioyvonne de 038271607 RFM vpn cogiomh com 074676920 rdg
n058153063159 netvigator com 093992055 fK0
c 76 109 104 153 hsd1 fl comcast net 050429194 fxh lnlawyer net 036508550 qnm
cpc94108 newt38 2 0 cust756 19 3 cable virginm net 087885080 avq
potzblitz friedrichshafen de 76587288 6Jo nillomonteiro tumblr com 56147589 ZmM
ori 84 117 nero net 90619738 CUI
usmcgeno tripod com 25884797 ECm mta 98 147 98 189 hawaii rr com 64310233 3WZ
reggaenights com 41126656 CDv
ppp 69 237 184 25 dsl sndg02 pacbell net 97738031 UTE 220 142 106 254 dynamic hinet net 11566642 A32
oczamiinncylud blogspot com 91081 qOW
globalfootballpro com mail protection outlook com 58021488 n8t googletraveller blogspot com 50327996 XU0
diwenbaoxianbingdai vvvqqq com 29135590 ita
n119s150 bbr1 shentel net 55207635 ztY pool 173 53 114 168 rcmdva fios verizon net 47530138 AWR
specials fakeschutz de 10974859 CVL
minghua m supfree net 77837634 npc neg leuchten de 68045913 heE
druckausgleichsrechner de 21956240 Nga
p57bdb3da dip0 t ipconnect de 82123619 otw course fanhao1314 com 47457732 npv
christoph schulz com 7246500 sVO
longhaichem com 29685561 LOK ziyg com 14513786 6aE
pool 74 96 211 33 washdc fios verizon net 26718692 ZB7
exhibitionservices net 79105323 m8A amazingsgalerysport blogspot com 85303947 roG
spss 64bits en softonic com 14987420 ZCl
oxoinvestments com 058770485 83n 2a fd 5546 static theplanet com 046904272 orc
paranoidparrotmeme tumblr com 059497612 TB7
fahr schulen de 041056834 fSP zjkywky com 061581774 rGW
pool 72 91 58 214 tampfl dsl w verizon net 08346458 6Hf
eau 2 ray skyrock com 097389648 nvy ip24 253 247 149 ok ok cox net 067994501 d5M
fahrrad garage stade de 064654853 sjg
109409 sanjianglive com 19175439 h58 c 69 255 143 76 hsd1 md comcast net 67559281 cPz
p4feea006 dip0 t ipconnect de 44190993 nWi
tuneskill com 20637212 AJd p57a2a17a dip0 t ipconnect de 96091949 s2c
thoserv de 69976588 d9v
jtownbarbershop com 20518229 hFu cip 109 107 37 200 gb1 brightbox com 64542865 q6c
veronika herbst de 53310190 Dww
h69 131 28 1 kgldga dsl dynamic tds net 23583374 737 alzner automotive de 54815129 X3t
tpufuhe vvvqqq com 73889504 uIv
160 red 79 146 76 dynamicip rima tde net 65609000 5s5 ozozel blogspot com 66741952 8Ug
charminggirlsindelhi blogspot com 11930872 rTB
imabayashi blog59 fc2 com 5759855 Moc gigglier com 58997629 E0Y
mta 69 75 146 140 socal rr com 78120195 cAY
75 173 194 159 clsp qwest net 43977454 reM stlukeshoreline net 89814254 z6z
shaffercarol livejournal com 33039551 9ri
ec2 54 65 78 36 ap northeast 1 compute amazonaws com 67260158 8e7 softbank060095095012 bbtec net 23224731 9yJ
mny3r sanjianglive com 16533385 dlD
thexsexy tomas skyrock com 38592983 OQa multi cxlor skyrock com 64522728 5dd
c 24 118 6 13 hsd1 mn comcast net 36972911 837